PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G2090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 307aa    MW: 35136.6 Da    PI: 8.1218
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G2090genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +++q+G+g+W++++ + g+ R+ k+c++rw +yl
      Gh_D07G2090 14 KGPWTPEEDLILVSYIQQHGPGNWRAVPTKTGLLRCSKSCRLRWANYL 61
                     79******************************99************97 PP

2Myb_DNA-binding47.73.6e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_D07G2090  67 RGNFTENEEKMIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.395961IPR017930Myb domain
SuperFamilySSF466892.9E-3011108IPR009057Homeodomain-like
SMARTSM007173.5E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001672.71E-101661No hitNo description
PROSITE profilePS5129423.95662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2465117IPR009057Homeodomain-like
SMARTSM007179.2E-1566114IPR001005SANT/Myb domain
PfamPF002492.6E-1467112IPR001005SANT/Myb domain
CDDcd001675.46E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRQPCCDKV GVKKGPWTPE EDLILVSYIQ QHGPGNWRAV PTKTGLLRCS KSCRLRWANY  60
LRPGIRRGNF TENEEKMIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLKKLQ  120
GNESSSRYGF PSSSSSYQIC RGQWERKLQT DIHMAKKDLS DALSPEKSSD LVEMKPFNDH  180
TSYPKPSGYA SSTENIAKLL KGWMRNNPWK MADSADYSEE GTVPMKEDKN SKEMAEAFQS  240
HLGFESLDSS LSDISPSMSP ETSLSQYESK PHLNAQSQLS LLEKWLFDEG KDYQLCDITL  300
DQNLHFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-26141164105MYB PROTO-ONCOGENE PROTEIN
1msf_C3e-26141164105C-Myb DNA-Binding Domain
1mse_C3e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.23440.0boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO737617040.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1182430.0DQ118243.1 Gossypium hirsutum myb transcription factor MYB30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441068.10.0PREDICTED: myb-related protein 306
SwissprotQ9SCU71e-111MYB30_ARATH; Transcription factor MYB30
TrEMBLQ2QDD50.0Q2QDD5_G
STRINGPOPTR_0004s12530.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-110myb domain protein 30